Product Browser

Last updated: 2017/6/25
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

B3GAT1 polyclonal antibody (A01)

  • Catalog # : H00027087-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant B3GAT1.
  • Immunogen:
  • B3GAT1 (NP_061114, 235 a.a. ~ 332 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • AGKVVRWKTVFDPHRPFAIDMAGFAVNLRLILQRSQAYFKLRGVKGGYQESSLLRELVTLNDLEPKAANCTKILVWHTRTEKPVLVNEGKKGFTDPSV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00027087-A01
    Western Blot detection against Immunogen (36.89 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • B3GAT1
  • Gene Alias:
  • CD57,GLCATP,GlcAT-P,GlcUAT-P,HNK-1,HNK1,LEU7,NK-1
  • Gene Description:
  • beta-1,3-glucuronyltransferase 1 (glucuronosyltransferase P)
  • Gene Summary:
  • The protein encoded by this gene is a member of the glucuronyltransferase gene family. These enzymes exhibit strict acceptor specificity, recognizing nonreducing terminal sugars and their anomeric linkages. This gene product functions as the key enzyme in a glucuronyl transfer reaction during the biosynthesis of the carbohydrate epitope HNK-1 (human natural killer-1, also known as CD57 and LEU7). Alternate transcriptional splice variants have been characterized. [provided by RefSeq
  • Other Designations:
  • CD57 antigen,LEU7 antigen,UDP-GlcUA:glycoprotein beta-1,3-glucuronyltransferase,beta-1,3-glucuronyltransferase 1,galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1,glucuronosyltransferase P
  • RSS
  • YouTube
  • Linkedin
  • Facebook