FOXP1 monoclonal antibody (M01), clone 4E3-G11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant FOXP1.
Immunogen
FOXP1 (AAH05055, 1 a.a. ~ 114 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQWHLINHQPSRSPSSWLKRLISSPWELEVLQVPLWGAVAETKMSGPVCQPNPSPF
Host
Mouse
Reactivity
Human
Isotype
IgG2b
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.28 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FOXP1 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — FOXP1
Entrez GeneID
27086GeneBank Accession#
BC005055Protein Accession#
AAH05055Gene Name
FOXP1
Gene Alias
12CC4, FLJ23741, HSPC215, MGC12942, MGC88572, MGC99551, QRF1, hFKH1B
Gene Description
forkhead box P1
Omim ID
605515Gene Ontology
HyperlinkGene Summary
This gene belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Forkhead box P1 protein contains both DNA-binding- and protein-protein binding-domains. This gene may act as a tumor suppressor as it is lost in several tumor types and maps to a chromosomal region (3p14.1) reported to contain a tumor suppressor gene(s). Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
fork head-related protein like B|glutamine-rich factor 1
-
Interactome
-
Disease
-
Publication Reference
-
Characterization of human FOXP1 isoform 2, using monoclonal antibody 4E3-G11, and intron retention as a tissue-specific mechanism generating a novel FOXP1 isoform.
Brown PJ, Kagaya R, Banham AH.
Histopathology 2008 Feb; 52(5):632.
Application:IHC-Fr, IHC-P, WB-Tr, Human, HEK 293T cells.
-
Characterization of human FOXP1 isoform 2, using monoclonal antibody 4E3-G11, and intron retention as a tissue-specific mechanism generating a novel FOXP1 isoform.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com