B9D1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of B9D1 expression in transfected 293T cell line (H00027077-T01) by B9D1 MaxPab polyclonal antibody.
Lane 1: EPPB9 transfected lysate(16.83 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human B9D1 protein.
Immunogen
B9D1 (AAH02944.1, 1 a.a. ~ 153 a.a) full-length human protein.
Sequence
MATASPSVFLLMVNGQVESAQFPEYDDLYCKYCFVYGQDWAPTAGLEEGISQITSKSQDVRQALVWNFPIDVTFKSTNPYGWPQIVLSVYGPDVFGNDVVRGYGAVHVPFSPGRHKRTIPMFVPESTSKLQKFTSLCLVASSDLQAAPPTEDK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of B9D1 expression in transfected 293T cell line (H00027077-T01) by B9D1 MaxPab polyclonal antibody.
Lane 1: EPPB9 transfected lysate(16.83 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — B9D1
Entrez GeneID
27077GeneBank Accession#
BC002944.2Protein Accession#
AAH02944.1Gene Name
B9D1
Gene Alias
B9, EPPB9
Gene Description
B9 protein domain 1
Gene Ontology
HyperlinkGene Summary
The B9 protein function is not known. Identification of a conserved mouse homolog and representation in the EST database indicates that this transcript does represent a gene. This gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq
Other Designations
B9 protein|endothelial precursor protein B9
-
Interactome
-
Publication Reference
-
TGF-β Signaling Regulates the Differentiation of Motile Cilia.
Janos Tözser , Ryan Earwood , Akiko Kato , Jacob Brown , Koichi Tanaka , Ruth Didier , Timothy L Megraw , Martin Blum , Yoichi Kato.
Cell Reports 2015 May; 11(7):1000.
Application：IF, Mouse, Mouse multi-ciliated cells.
-
TGF-β Signaling Regulates the Differentiation of Motile Cilia.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com