VPS41 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of VPS41 expression in transfected 293T cell line by VPS41 polyclonal antibody (A01).
Lane1:VPS41 transfected lysate (Predicted MW: 98.5 KDa).
Lane2:Non-transfected lysate.
Western Blot detection against Immunogen (37 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant VPS41.
Immunogen
VPS41 (NP_055211, 755 a.a. ~ 853 a.a) partial recombinant protein with GST tag.
Sequence
LLREGCKKILVADSLSLLKKMHRTQMKGVLVDEENICESCLSPILPSDAAKPFSVVVFHCRHMFHKECLPMPSMNSAAQFCNICSAKNRGPGSAILEMK
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of VPS41 expression in transfected 293T cell line by VPS41 polyclonal antibody (A01).
Lane1:VPS41 transfected lysate (Predicted MW: 98.5 KDa).
Lane2:Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
-
Gene Info — VPS41
Entrez GeneID
27072GeneBank Accession#
NM_014396Protein Accession#
NP_055211Gene Name
VPS41
Gene Alias
HVPS41, HVSP41, hVps41p
Gene Description
vacuolar protein sorting 41 homolog (S. cerevisiae)
Omim ID
605485Gene Ontology
HyperlinkGene Summary
Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene encodes the human ortholog of yeast Vps41 protein which is also conserved in Drosophila, tomato, and Arabidopsis. Expression studies in yeast and human indicate that this protein may be involved in the formation and fusion of transport vesicles from the Golgi. Several transcript variants encoding different isoforms have been described for this gene, however, the full-length nature of not all is known. [provided by RefSeq
Other Designations
OTTHUMP00000025247|vacuolar assembly protein 41|vacuolar protein sorting 41
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com