Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ACAD8 polyclonal antibody (A01)

  • Catalog # : H00027034-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant ACAD8.
  • Immunogen:
  • ACAD8 (NP_055199, 306 a.a. ~ 415 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • GEPLASNQYLQFTLADMATRLVAARLMVRNAAVALQEERKDAVALCSMAKLFATDECFAICNQALQMHGGYGYLKDYAVQQYVRDSRVHQILEGSNEVMRILISRSLLQE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • ACAD8 polyclonal antibody (A01), Lot # 060126JC01 Western Blot analysis of ACAD8 expression in SJCRH30 ( Cat # L027V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • ELISA
  • Gene Information
  • Gene Name:
  • ACAD8
  • Gene Alias:
  • ACAD-8,FLJ22590
  • Gene Description:
  • acyl-Coenzyme A dehydrogenase family, member 8
  • Gene Summary:
  • Isobutyryl-CoA dehydrogenase (EC 1.3.99), encoded by the ACAD8 gene, catalyzes the third step of the degradation of the branched chain amino acid valine (Nguyen et al., 2002 [PubMed 12359132]).[supplied by OMIM
  • Other Designations:
  • acyl-coenzyme A dehydrogenase 8
  • RSS
  • YouTube
  • Linkedin
  • Facebook