ATP2C1 monoclonal antibody (M01), clone 2G1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ATP2C1.
Immunogen
ATP2C1 (AAH28139, 119 a.a. ~ 269 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPAATNGDLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQL
Host
Mouse
Reactivity
Human
Isotype
IgG1 lambda
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (42.35 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ATP2C1 monoclonal antibody (M01), clone 2G1 Western Blot analysis of ATP2C1 expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of ATP2C1 expression in transfected 293T cell line by ATP2C1 monoclonal antibody (M01), clone 2G1.
Lane 1: ATP2C1 transfected lysate(100.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of ATP2C1 transfected lysate using anti-ATP2C1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ATP2C1 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ATP2C1 is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of ATP2C1 over-expressed 293 cell line, cotransfected with ATP2C1 Validated Chimera RNAi ( Cat # H00027032-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ATP2C1 monoclonal antibody (M01), clone 2G1 (Cat # H00027032-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to ATP2C1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — ATP2C1
Entrez GeneID
27032GeneBank Accession#
BC028139Protein Accession#
AAH28139Gene Name
ATP2C1
Gene Alias
ATP2C1A, BCPM, HHD, KIAA1347, PMR1, SPCA1, hSPCA1
Gene Description
ATPase, Ca++ transporting, type 2C, member 1
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the family of P-type cation transport ATPases. This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of the calcium. Defects in this gene cause Hailey-Hailey disease, an autosomal dominant disorder. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
ATP-dependent Ca(2+) pump|ATPase 2C1|ATPase, Ca(2+)-sequestering|HUSSY-28|calcium-transporting ATPase 2C1|secretory pathway Ca2+/Mn2+ ATPase
-
Interactome
-
Publication Reference
-
The Golgi calcium ATPase pump plays an essential role in AAV trafficking and transduction.
Victoria J Madigan, Garrett E Berry, Tyne O Tyson, Dasean Nardone-White, Jonathan Ark, Zachary C Elmore, Giridhar Murlidharan, Heather A Vincent, Aravind Asokan.
Journal of Virology 2020 Oct; 94(21):e01604.
Application:WB-Tr, Human, Huh7 cells.
-
Activity of the SPCA1 Calcium Pump Couples Sphingomyelin Synthesis to Sorting of Secretory Proteins in the Trans-Golgi Network.
Deng Y, Pakdel M, Blank B, Sundberg EL, Burd CG, von Blume J.
Developmental Cell 2018 Nov; 47(4):464.
Application:IF, Human, HeLa cells.
-
Diverse Viruses Require the Calcium Transporter SPCA1 for Maturation and Spread.
Hoffmann HH, Schneider WM, Blomen VA, Scull MA, Hovnanian A, Brummelkamp TR, Rice CM.
Cell Host & Microbe 2017 Oct; 22(4):460.
Application:WB-Ce, Human, Hap1 cells.
-
Cofilin recruits F-actin to SPCA1 and promotes Ca2+-mediated secretory cargo sorting.
Kienzle C, Basnet N, Crevenna AH, Beck G, Habermann B, Mizuno N, von Blume J.
The Journal of Cell Biology 2014 Sep; 206(5):635.
Application:IF, Human, HeLa cells.
-
Golgi calcium pump secretory pathway calcium ATPase 1 (SPCA1) is a key regulator of insulin-like growth factor receptor (IGF1R) processing in the basal-like breast cancer cell line MDA-MB-231.
Grice DM, Vetter I, Faddy HM, Kenny PA, Roberts-Thomson SJ, Monteith GR.
The Journal of Biological Chemistry 2010 Nov; 285(43):37458.
Application:WB-Tr, Human, MDA-MB-231 cells.
-
The Golgi calcium ATPase pump plays an essential role in AAV trafficking and transduction.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com