USP21 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human USP21 partial ORF ( NP_036607, 466 a.a. - 565 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
FSASRGSIKKSSVGVDFPLQRLSLGDFASDKAGSPVYQLYALCNHSGSVHYGHYTALCRCQTGWHVYNDSRVSPVSENQVASSEGYVLFYQLMQEPPRCL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.74
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — USP21
Entrez GeneID
27005GeneBank Accession#
NM_012475Protein Accession#
NP_036607Gene Name
USP21
Gene Alias
MGC3394, USP16, USP23
Gene Description
ubiquitin specific peptidase 21
Omim ID
604729Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the C19 peptidase family, also known as family 2 of ubiquitin carboxy-terminal hydrolases. The encoded protein cleaves ubiquitin from ubiquitinated proteins for recycling in intracellular protein degradation. The encoded protein is also able to release NEDD8, a ubiquitin-like protein, from NEDD8-conjugated proteins. This gene has been referred to as USP16 and USP23 but is now known as USP21. Alternatively spliced transcript variants have been described. [provided by RefSeq
Other Designations
NEDD8-specific protease|deubiquitinating enzyme 21|ubiquitin carboxyl-terminal hydrolase 21|ubiquitin specific protease 21|ubiquitin thiolesterase 21|ubiquitin-specific processing protease 21|ubiquitin-specific protease 16|ubiquitin-specific protease 21
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com