Product Browser

Last updated: 2017/2/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TCL6 (Human) Recombinant Protein (P01)

  • Catalog # : H00027004-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TCL6 full-length ORF ( ADR82666.1, 1 a.a. - 141 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MEPRVTQRKRPLDGCMGKITGITSDILKYDHKCFKLSLPAKFPEVCGSDEVFPDPDLLHVLPVAGSLQQSIDQCCLQLESLCRPGLLCAHPTLLFKLHSSMKNRPFFSLIYTYVKKTQQVRKRDRKPRGQVAAGPNPTSVM
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 15.6
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • TCL6
  • Gene Alias:
  • TCL6e1,TCL6f1,TCL6f2,TNG1,TNG2
  • Gene Description:
  • T-cell leukemia/lymphoma 6
  • Gene Summary:
  • The function of this protein has not yet been defined; however, this protein may play a role which is similar to or complementary to other T-cell leukemia/lymphoma proteins during early embrogenesis. The association of this gene with T-cell leukemia chromosome translocations implicates this gene as a candidate for leukemogenesis. Complex alternative splicing of this gene results in multiple transcript variants, six of which have been fully described. Among these described variants, four different open reading frames have been identified; three of the six variants code for an identical product.
  • Other Designations:
  • OTTHUMP00000195767,T-cell leukemia/lymphoma 6 ORF141,T-cell leukemia/lymphoma 6 ORF72,TCL1-neighboring gene 1,TCL1-neighboring gene 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook