TCL6 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human TCL6 full-length ORF ( ADR82666.1, 1 a.a. - 141 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MEPRVTQRKRPLDGCMGKITGITSDILKYDHKCFKLSLPAKFPEVCGSDEVFPDPDLLHVLPVAGSLQQSIDQCCLQLESLCRPGLLCAHPTLLFKLHSSMKNRPFFSLIYTYVKKTQQVRKRDRKPRGQVAAGPNPTSVM
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
15.6
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — TCL6
Entrez GeneID
27004GeneBank Accession#
HQ257911.1Protein Accession#
ADR82666.1Gene Name
TCL6
Gene Alias
TCL6e1, TCL6f1, TCL6f2, TNG1, TNG2
Gene Description
T-cell leukemia/lymphoma 6
Omim ID
604412Gene Ontology
HyperlinkGene Summary
The function of this protein has not yet been defined; however, this protein may play a role which is similar to or complementary to other T-cell leukemia/lymphoma proteins during early embrogenesis. The association of this gene with T-cell leukemia chromosome translocations implicates this gene as a candidate for leukemogenesis. Complex alternative splicing of this gene results in multiple transcript variants, six of which have been fully described. Among these described variants, four different open reading frames have been identified; three of the six variants code for an identical product.
Other Designations
OTTHUMP00000195767|T-cell leukemia/lymphoma 6 ORF141|T-cell leukemia/lymphoma 6 ORF72|TCL1-neighboring gene 1|TCL1-neighboring gene 2
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com