Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TCL6 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00027004-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human TCL6 protein.
  • Immunogen:
  • TCL6 (ADR82666.1, 1 a.a. ~ 141 a.a) full-length human protein.
  • Sequence:
  • MEPRVTQRKRPLDGCMGKITGITSDILKYDHKCFKLSLPAKFPEVCGSDEVFPDPDLLHVLPVAGSLQQSIDQCCLQLESLCRPGLLCAHPTLLFKLHSSMKNRPFFSLIYTYVKKTQQVRKRDRKPRGQVAAGPNPTSVM
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Application Image
  • Western Blot (Transfected lysate)
  • Gene Information
  • Gene Name:
  • TCL6
  • Gene Alias:
  • TCL6e1,TCL6f1,TCL6f2,TNG1,TNG2
  • Gene Description:
  • T-cell leukemia/lymphoma 6
  • Gene Summary:
  • The function of this protein has not yet been defined; however, this protein may play a role which is similar to or complementary to other T-cell leukemia/lymphoma proteins during early embrogenesis. The association of this gene with T-cell leukemia chromosome translocations implicates this gene as a candidate for leukemogenesis. Complex alternative splicing of this gene results in multiple transcript variants, six of which have been fully described. Among these described variants, four different open reading frames have been identified; three of the six variants code for an identical product.
  • Other Designations:
  • OTTHUMP00000195767,T-cell leukemia/lymphoma 6 ORF141,T-cell leukemia/lymphoma 6 ORF72,TCL1-neighboring gene 1,TCL1-neighboring gene 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook