OR4D1 (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human OR4D1 full-length ORF (NP_036506.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).Sequence
MEPQNTTQVSMFVLLGFSQTQELQKFLFLLFLLVYVTTIVGNLLIMVTVTFDCRLHTPMYFLLRNLALIDLCYSTVTSPKMLVDFLHETKTISYQGCMAQIFFFHLLGGGTVFFLSVMAYDRYIAISQPLRYVTIMNTQLCVGLVVAAWVGGFVHSIVQLALILPLPFCGPNILDNFYCDVPQVLRLACTDTSLLEFLMISNSGLLVIIWFLLLLISYTVILVMLRSHSGKARRKAASTCTTHIIVVSMIFIPCIYIYTWPFTPFLMDKAVSISYTVMTPMLNPMIYTLRNQDMKAAMRRLGKCLVICRE
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.2
Form
Liquid
Preparation Method
in vitro wheat germ expression system with proprietary liposome technology
Purification
None
Recommend Usage
Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Storage Buffer
25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Antibody Production
-
Gene Info — OR4D1
Entrez GeneID
26689GeneBank Accession#
NM_012374.1Protein Accession#
NP_036506.1Gene Name
OR4D1
Gene Alias
OR17-23, OR4D3, OR4D4P, TPCR16
Gene Description
olfactory receptor, family 4, subfamily D, member 1
Gene Ontology
HyperlinkGene Summary
Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq
Other Designations
olfactory receptor OR17-23 pseudogene|olfactory receptor, family 4, subfamily D, member 3|olfactory receptor, family 4, subfamily D, member 4 pseudogene|seven transmembrane helix receptor
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com