ELP4 MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of ELP4 expression in transfected 293T cell line (H00026610-T01) by ELP4 MaxPab polyclonal antibody.
Lane 1: ELP4 transfected lysate(58.85 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to ELP4 on HepG2 cell. [antibody concentration 20 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human ELP4 protein.
Immunogen
ELP4 (AAH12514.1, 1 a.a. ~ 535 a.a) full-length human protein.
Sequence
MAAVATCGSVAASTGSAVATASKSNVTSFQRRGPRASVTNDSGPRLVSIAGTRPSVRNGQLLVSTGLPALDQLLGGGLAVGTVLLIEEDKYNIYSPLLFKYFLAEGIVNGHTLLVASAKEDPANILQELPAPLLDDKCKKEFDEDVYNHKTPESNIKMKIAWRYQLLPKMEIGPVSSSRFGHYYDASKRMPQELIEASNWHGFFLPEKISSTLKVEPCSLTPGYTKLLQFIQNIIYEEGFDGSNPQKKQRNILRIGIQNLGSPLWGDDICCAENGGNSHSLTKFLYVLRGLLRTSLSACIITMPTHLIQNKAIIARVTTLSDVVVGLESFIGSERETNPLYKDYHGLIHIRQIPRLNNLICDESDVKDLAFKLKRKLFTIEAGVQWHDLGSRRPRLLGSGGSPASASLVAGITGAHHHAQLIFVFLVEMGFHHVGQAGLELLTSGDSSASASQSAGIAGMSYRARPRALYFKENKSKVGARQLLETREEHLSSRLLILTQAERLCMGRRFFTAFHIFNELPCKGDCICLQTCQTQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (77)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ELP4 expression in transfected 293T cell line (H00026610-T01) by ELP4 MaxPab polyclonal antibody.
Lane 1: ELP4 transfected lysate(58.85 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to ELP4 on HepG2 cell. [antibody concentration 20 ug/ml] -
Gene Info — ELP4
Entrez GeneID
26610GeneBank Accession#
BC012514.1Protein Accession#
AAH12514.1Gene Name
ELP4
Gene Alias
C11orf19, FLJ20498, PAX6NEB, PAXNEB, dJ68P15A.1
Gene Description
elongation protein 4 homolog (S. cerevisiae)
Omim ID
606985Gene Ontology
HyperlinkGene Summary
This gene encodes a component of the six subunit elongator complex, a histone acetyltransferase complex that associates directly with RNA polymerase II during transcriptional elongation. The human gene can partially complement sensitivity phenotypes of yeast ELP4 deletion mutants. Alternatively spliced variants that encode different protein isoforms have been described but the full-length nature of only one has been determined. [provided by RefSeq
Other Designations
PAX6 neighbor|elongation protein 4 homolog
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com