Product Browser

Last updated: 2017/12/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ELP4 polyclonal antibody (A01)

  • Catalog # : H00026610-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant ELP4.
  • Immunogen:
  • ELP4 (NP_061913, 101 a.a. ~ 199 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • YFLAEGIVNGHTLLVASAKEDPANILQELPAPLLDDKCKKEFDEDVYNHKTPESNIKMKIAWRYQLLPKMEIGPVSSSRFGHYYDASKRMPQELIEASN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00026610-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • ELP4 polyclonal antibody (A01), Lot # 060623JCS1 Western Blot analysis of ELP4 expression in Y-79 ( Cat # L042V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • ELP4
  • Gene Alias:
  • C11orf19,FLJ20498,PAX6NEB,PAXNEB,dJ68P15A.1
  • Gene Description:
  • elongation protein 4 homolog (S. cerevisiae)
  • Gene Summary:
  • This gene encodes a component of the six subunit elongator complex, a histone acetyltransferase complex that associates directly with RNA polymerase II during transcriptional elongation. The human gene can partially complement sensitivity phenotypes of yeast ELP4 deletion mutants. Alternatively spliced variants that encode different protein isoforms have been described but the full-length nature of only one has been determined. [provided by RefSeq
  • Other Designations:
  • PAX6 neighbor,elongation protein 4 homolog
  • RSS
  • YouTube
  • Linkedin
  • Facebook