BSCL2 polyclonal antibody (A02)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant BSCL2.
Immunogen
BSCL2 (NP_116056, 263 a.a. ~ 354 a.a) partial recombinant protein with GST tag.
Sequence
WPRHRFSLQVNIRKRDNSRKEVQRRISAHQPGPEGQEESTPQSDVTEDGESPEDPSGTEGQLSEEEKPDQQPLSGEEELEPEASDGSGSWED
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.23 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
BSCL2 polyclonal antibody (A02). Western Blot analysis of BSCL2 expression in Jurkat.Western Blot (Transfected lysate)
Western Blot analysis of BSCL2 expression in transfected 293T cell line by BSCL2 polyclonal antibody (A02).
Lane1:BSCL2 transfected lysate (Predicted MW: 44.5 KDa).
Lane2:Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
-
Gene Info — BSCL2
Entrez GeneID
26580GeneBank Accession#
NM_032667Protein Accession#
NP_116056Gene Name
BSCL2
Gene Alias
GNG3LG, HMN5, MGC4694, SPG17
Gene Description
Bernardinelli-Seip congenital lipodystrophy 2 (seipin)
Gene Ontology
HyperlinkGene Summary
This gene encodes protein seipin, which is located in the endoplasmic reticulum and may be important for lipid droplet morphology. Mutations in this gene have been associated with congenital generalized lipodystrophy type 2 or Berardinelli-Seip syndrome, a rare autosomal recessive disease characterized by a near absence of adipose tissue and severe insulin resistance. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
seipin
-
Interactome
-
Disease
-
Publication Reference
-
Parallel CRISPR-Cas9 screens identify mechanisms of PLIN2 and lipid droplet regulation.
Melissa A Roberts, Kirandeep K Deol, Alyssa J Mathiowetz, Mike Lange, Dara E Leto, Julian Stevenson, Sayed Hadi Hashemi, David W Morgens, Emilee Easter, Kartoosh Heydari, Mike A Nalls, Michael C Bassik, Martin Kampmann, Ron R Kopito, Faraz Faghri, James A Olzmann.
Developmental Cell 2023 Sep; 58(18):1782.
Application:WB-Tr, Human, Huh7 cell.
-
Multiple C2 domain-containing transmembrane proteins promote lipid droplet biogenesis and growth at specialized ER subdomains.
Amit S Joshi, Joey V Ragusa, William A Prinz, Sarah Cohen.
Molecular Biology of the Cell 2021 Jun; 32(12):1147.
Application:IF, WB-Tr, Monkey, COS-7 cells.
-
LDAF1 and Seipin Form a Lipid Droplet Assembly Complex.
Chung J, Wu X, Lambert TJ, Lai ZW, Walther TC, Farese RV Jr.
Developmental Cell 2019 Dec; 51(5):551.
Application:WB-Tr, Human, SUM159 cells.
-
The ER-Localized Protein DFCP1 Modulates ER-Lipid Droplet Contact Formation.
Li D, Zhao YG, Li D, Zhao H, Huang J, Miao G, Feng D, Liu P, Li D, Zhang H.
Cell Reports 2019 Apr; 27(2):343.
Application:WB-Tr, Human, Monkey, COS-7, HeLa cells.
-
Adipose-specific knockout of Seipin/Bscl2 results in progressive lipodystrophy.
Liu L, Jiang Q, Wang X, Zhang Y, Lin RC, Lam SM, Shui G, Zhou L, Li P, Wang Y, Cui X, Gao M, Zhang L, Lv Y, Xu G, Liu G, Zhao D, Yang H.
Diabetes 2014 Jul; 63(7):2320.
Application:WB-Ti, Mouse, Adipose tissue.
-
Overexpression of a short human seipin/BSCL2 isoform in mouse adipose tissue results in mild lipodystrophy.
Cui X, Wang Y, Meng L, Fei W, Deng J, Xu G, Peng X, Ju S, Zhang L, Liu G, Zhao L, Yang H.
American Journal of Physiology. Endocrinology and Metabolism 2012 Mar; 302(6):E705.
Application:WB-Ti, Mouse, White adipose, Brown adipose tissue, Liver, Kidney, Heart.
-
Parallel CRISPR-Cas9 screens identify mechanisms of PLIN2 and lipid droplet regulation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com