Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IL36RN (Human) Recombinant Protein (P01)

  • Catalog # : H00026525-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IL36RN full-length ORF ( NP_036407.1, 1 a.a. - 155 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 43.4
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • IL36RN
  • Gene Alias:
  • UNQ1896/PRO4342,FIL1,FIL1(DELTA),FIL1D,IL1F5,IL1HY1,IL1L1,IL1RP3,IL36RA,PSORP
  • Gene Description:
  • interleukin 36 receptor antagonist
  • Gene Summary:
  • The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine was shown to specifically inhibit the activation of NF-kappaB induced by interleukin 1 family, member 6 (IL1F6). This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq
  • Other Designations:
  • IL-1 related protein 3; IL-1F5 (IL-1HY1, FIL1-delta, IL-1RP3, IL-1L1, IL-1-delta); IL-1ra homolog 1; IL1F5 (Canonical product IL-1F5a); family of interleukin 1-delta; interleukin 1 family, member 5 (delta); interleukin-1 HY1; interleukin-1 receptor antago
  • RSS
  • YouTube
  • Linkedin
  • Facebook