Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EIF2C1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00026523-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human EIF2C1 partial ORF ( NP_036331, 101 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • VTALPIGNERVDFEVTIPGEGKDRIFKVSIKWLAIVSWRMLHEALVSGQIPVPLESVQALDVAMRHLASMRYTPVGRSFFSPPEGYYHPLGGGREVWFGF
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00026523-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • EIF2C1
  • Gene Alias:
  • AGO1,DKFZp686M13167,EIF2C,GERP95,Q99
  • Gene Description:
  • eukaryotic translation initiation factor 2C, 1
  • Gene Summary:
  • This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. This gene is located on chromosome 1 in a cluster of closely related family members including argonaute 3, and argonaute 4. [provided by RefSeq
  • Other Designations:
  • Golgi Endoplasmic Reticulum protein 95 kDa,OTTHUMP00000008519,argonaute 1,putative RNA-binding protein Q99
  • RSS
  • YouTube
  • Linkedin
  • Facebook