TIMM8B (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human TIMM8B full-length ORF ( NP_036591.1, 1 a.a. - 83 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MAELGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENCLSSCVDRFIDTTLAITSRFAQIVQKGGQ
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.7
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — TIMM8B
Entrez GeneID
26521GeneBank Accession#
NM_012459.1Protein Accession#
NP_036591.1Gene Name
TIMM8B
Gene Alias
DDP2, FLJ21744, MGC102866, MGC117373, TIM8B
Gene Description
translocase of inner mitochondrial membrane 8 homolog B (yeast)
Omim ID
606659Gene Ontology
HyperlinkGene Summary
This gene encodes a member of a well-conserved family of proteins with similarity to yeast Tim mitochondrial import proteins. This gene is encoded by a nuclear gene and is transported into the intermembrane space of the mitochondrion. When formed into complexes, these proteins guide membrane-spanning proteins across the mitochondrial intermembrane space before they are added into the mitochondrial inner membrane. This gene is adjacent to succinate dehydrogenase, subunit D (SDHD), in which mutations have been found in affected members of families with hereditary paraganglioma
Other Designations
mitochondrial import inner membrane translocase subunit Tim8 B|translocase of inner mitochondrial membrane 8 homolog B
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com