TIMM8B monoclonal antibody (M01), clone 2G7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TIMM8B is 3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (34.87 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TIMM8B.
Immunogen
TIMM8B (NP_036591, 1 a.a. ~ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAELGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENCLSSCVDRFIDTTLAITSRFAQIVQKGGQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.87 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TIMM8B is 3 ng/ml as a capture antibody.ELISA
-
Gene Info — TIMM8B
Entrez GeneID
26521GeneBank Accession#
NM_012459Protein Accession#
NP_036591Gene Name
TIMM8B
Gene Alias
DDP2, FLJ21744, MGC102866, MGC117373, TIM8B
Gene Description
translocase of inner mitochondrial membrane 8 homolog B (yeast)
Omim ID
606659Gene Ontology
HyperlinkGene Summary
This gene encodes a member of a well-conserved family of proteins with similarity to yeast Tim mitochondrial import proteins. This gene is encoded by a nuclear gene and is transported into the intermembrane space of the mitochondrion. When formed into complexes, these proteins guide membrane-spanning proteins across the mitochondrial intermembrane space before they are added into the mitochondrial inner membrane. This gene is adjacent to succinate dehydrogenase, subunit D (SDHD), in which mutations have been found in affected members of families with hereditary paraganglioma
Other Designations
mitochondrial import inner membrane translocase subunit Tim8 B|translocase of inner mitochondrial membrane 8 homolog B
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com