TIMM9 monoclonal antibody (M01), clone 1D6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a full length recombinant TIMM9.
Immunogen
TIMM9 (AAH20213, 1 a.a. ~ 89 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (97); Rat (98)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.53 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TIMM9 monoclonal antibody (M01), clone 1D6. Western Blot analysis of TIMM9 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
TIMM9 monoclonal antibody (M01), clone 1D6 Western Blot analysis of TIMM9 expression in IMR-32 ( Cat # L008V1 ).Western Blot (Cell lysate)
TIMM9 monoclonal antibody (M01), clone 1D6. Western Blot analysis of TIMM9 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
TIMM9 monoclonal antibody (M01), clone 1D6. Western Blot analysis of TIMM9 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Transfected lysate)
Western Blot analysis of TIMM9 expression in transfected 293T cell line by TIMM9 monoclonal antibody (M01), clone 1D6.
Lane 1: TIMM9 transfected lysate(10.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TIMM9 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TIMM9 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — TIMM9
Entrez GeneID
26520GeneBank Accession#
BC020213Protein Accession#
AAH20213Gene Name
TIMM9
Gene Alias
TIM9, TIM9A
Gene Description
translocase of inner mitochondrial membrane 9 homolog (yeast)
Omim ID
607384Gene Ontology
HyperlinkGene Summary
TIMM9 belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondrial inner membrane.[supplied by OMIM
Other Designations
OTTHUMP00000179028|translocase of inner mitochondrial membrane 9 homolog
-
Interactomes
-
Publication Reference
-
High expression of mitochondrial intermembrane chaperone TIMM9 represents a negative prognostic marker in gastric cancer.
Lin CC, Fang CL, Sun DP, Hseu YC, Uen YH, Lin KY, Lin YC.
Journal of the Formosan Medical Association 2016 Oct; [Epub].
Application:WB, IHC-P, Human, Gastric cancer, Hs738, AGS, NCI-N87, TMC-1, TSGH 9201 cells.
-
High expression of mitochondrial intermembrane chaperone TIMM9 represents a negative prognostic marker in gastric cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com