Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TIMM9 polyclonal antibody (A01)

  • Catalog # : H00026520-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length recombinant TIMM9.
  • Immunogen:
  • TIMM9 (AAH20213, 1 a.a. ~ 89 a.a) full-length recombinant protein with GST tag.
  • Sequence:
  • MAAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00026520-A01
    Western Blot detection against Immunogen (35.9 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • TIMM9
  • Gene Alias:
  • TIM9,TIM9A
  • Gene Description:
  • translocase of inner mitochondrial membrane 9 homolog (yeast)
  • Gene Summary:
  • TIMM9 belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondrial inner membrane.[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000179028,translocase of inner mitochondrial membrane 9 homolog
  • RSS
  • YouTube
  • Linkedin
  • Facebook