Product Browser

Last updated: 2017/6/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TIMM13 (Human) Recombinant Protein (P01)

  • Catalog # : H00026517-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TIMM13 full-length ORF ( AAH08607, 1 a.a. - 95 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMDAWNTVSRAYNSRLQRERANM
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.19
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00026517-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • TIMM13
  • Gene Alias:
  • TIM13,TIM13B,TIMM13A,TIMM13B,ppv1
  • Gene Description:
  • translocase of inner mitochondrial membrane 13 homolog (yeast)
  • Gene Summary:
  • This gene encodes a translocase with similarity to yeast mitochondrial proteins that are involved in the import of metabolite transporters from the cytoplasm and into the mitochondrial inner membrane. The encoded protein and the TIMM8a protein form a 70 kDa complex in the intermembrane space. This gene is in a head-to-tail orientation with the gene for lamin B2. [provided by RefSeq
  • Other Designations:
  • mitochondrial import inner membrane translocase subunit Tim13B,translocase of inner mitochondrial membrane 13
  • RSS
  • YouTube
  • Linkedin
  • Facebook