TIMM13 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human TIMM13 full-length ORF ( AAH08607, 1 a.a. - 95 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMDAWNTVSRAYNSRLQRERANM
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.19
Interspecies Antigen Sequence
Mouse (94); Rat (94)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — TIMM13
Entrez GeneID
26517GeneBank Accession#
BC008607Protein Accession#
AAH08607Gene Name
TIMM13
Gene Alias
TIM13, TIM13B, TIMM13A, TIMM13B, ppv1
Gene Description
translocase of inner mitochondrial membrane 13 homolog (yeast)
Omim ID
607383Gene Ontology
HyperlinkGene Summary
This gene encodes a translocase with similarity to yeast mitochondrial proteins that are involved in the import of metabolite transporters from the cytoplasm and into the mitochondrial inner membrane. The encoded protein and the TIMM8a protein form a 70 kDa complex in the intermembrane space. This gene is in a head-to-tail orientation with the gene for lamin B2. [provided by RefSeq
Other Designations
mitochondrial import inner membrane translocase subunit Tim13B|translocase of inner mitochondrial membrane 13
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com