FXC1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of FXC1 expression in transfected 293T cell line (H00026515-T01) by FXC1 MaxPab polyclonal antibody.
Lane 1: FXC1 transfected lysate(11.33 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human FXC1 protein.
Immunogen
FXC1 (AAH11014.1, 1 a.a. ~ 103 a.a) full-length human protein.
Sequence
MERQQQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCVGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPSVAAEQPGVSPSGS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (89); Rat (90)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of FXC1 expression in transfected 293T cell line (H00026515-T01) by FXC1 MaxPab polyclonal antibody.
Lane 1: FXC1 transfected lysate(11.33 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — FXC1
Entrez GeneID
26515GeneBank Accession#
BC011014.1Protein Accession#
AAH11014.1Gene Name
FXC1
Gene Alias
TIM10B, TIMM10B, Tim9b
Gene Description
fracture callus 1 homolog (rat)
Omim ID
607388Gene Ontology
HyperlinkGene Summary
FXC1, or TIMM10B, belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondrial inner membrane.[supplied by OMIM
Other Designations
fractured callus expressed transcript 1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com