Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FXC1 MaxPab mouse polyclonal antibody (B01)MaxPab

  • Catalog # : H00026515-B01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human FXC1 protein.
  • Immunogen:
  • FXC1 (AAH11014.1, 1 a.a. ~ 103 a.a) full-length human protein.
  • Sequence:
  • MERQQQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCVGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPSVAAEQPGVSPSGS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of FXC1 expression in transfected 293T cell line (H00026515-T01) by FXC1 MaxPab polyclonal antibody.

    Lane 1: FXC1 transfected lysate(11.33 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • FXC1
  • Gene Alias:
  • TIM10B,TIMM10B,Tim9b
  • Gene Description:
  • fracture callus 1 homolog (rat)
  • Gene Summary:
  • FXC1, or TIMM10B, belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondrial inner membrane.[supplied by OMIM
  • Other Designations:
  • fractured callus expressed transcript 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook