HEYL monoclonal antibody (M12), clone 3D3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
HEYL monoclonal antibody (M12), clone 3D3. Western Blot analysis of HEYL expression in human pancreas.
Western Blot (Cell lysate)
HEYL monoclonal antibody (M12), clone 3D3 Western Blot analysis of HEYL expression in SW-13 ( Cat # L005V1 ).
Western Blot (Cell lysate)
HEYL monoclonal antibody (M12), clone 3D3. Western Blot analysis of HEYL expression in U-2 OS.
Western Blot (Cell lysate)
HEYL monoclonal antibody (M12), clone 3D3. Western Blot analysis of HEYL expression in A-431.
Western Blot detection against Immunogen (33.7 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant HEYL.
Immunogen
HEYL (NP_055386, 1 a.a. ~ 70 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKRRGIIEKRRRDRINSSLSELRRLV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (78); Rat (79)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.7 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
HEYL monoclonal antibody (M12), clone 3D3. Western Blot analysis of HEYL expression in human pancreas.Western Blot (Cell lysate)
HEYL monoclonal antibody (M12), clone 3D3 Western Blot analysis of HEYL expression in SW-13 ( Cat # L005V1 ).Western Blot (Cell lysate)
HEYL monoclonal antibody (M12), clone 3D3. Western Blot analysis of HEYL expression in U-2 OS.Western Blot (Cell lysate)
HEYL monoclonal antibody (M12), clone 3D3. Western Blot analysis of HEYL expression in A-431.Western Blot (Recombinant protein)
ELISA
-
Gene Info — HEYL
Entrez GeneID
26508GeneBank Accession#
NM_014571Protein Accession#
NP_055386Gene Name
HEYL
Gene Alias
HRT3, MGC12623, bHLHb33
Gene Description
hairy/enhancer-of-split related with YRPW motif-like
Omim ID
609034Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcription factors. The sequence of the encoded protein contains a conserved bHLH and orange domain, but its YRPW motif has diverged from other HESR family members. It is thought to be an effector of Notch signaling and a regulator of cell fate decisions. Alternatively spliced transcript variants have been found, but their biological validity has not been determined. [provided by RefSeq
Other Designations
HEY-like protein|OTTHUMP00000000536|hairy-related transcription factor 3
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com