PTPN18 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of PTPN18 expression in transfected 293T cell line (H00026469-T01) by PTPN18 MaxPab polyclonal antibody.
Lane 1: PTPN18 transfected lysate(38.61 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to PTPN18 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human PTPN18 protein.
Immunogen
PTPN18 (AAH52800.1, 1 a.a. ~ 351 a.a) full-length human protein.
Sequence
MSRSLDSARSFLERLEARGGREGAVLAGEFSKRCERYWAQEQEPLQTGLFCITLIKEKWLNEDIMLRTLKVTFQKESRSVYQLQYMSWPDRGVPSSPDHMLAMVEEARRLQGSGPEPLCVHCSAGCGRTGVLCTVDYVRQLLLTQMIPPDFSLFDVVLKMRKQRPAAVQTEEQYRFLYHTVAQMFCSTLQNASPHYQNIKENCAPLYDDALFLRTPQALLAIPRPPGGVLRSISVPGSPGHAMADTYAVVQKRGAPAGAGSGTQTGTGTGARSAEEAPLYSKVTPRAQRPGAHAEDARGTLPGRVPADQSPAGSGAYEDVAGGAQTGGLGFNLRIGRPKGPRDPPAEWTRV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (74); Rat (73)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of PTPN18 expression in transfected 293T cell line (H00026469-T01) by PTPN18 MaxPab polyclonal antibody.
Lane 1: PTPN18 transfected lysate(38.61 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to PTPN18 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — PTPN18
Entrez GeneID
26469GeneBank Accession#
BC052800.1Protein Accession#
AAH52800.1Gene Name
PTPN18
Gene Alias
BDP1, PTP-HSCF
Gene Description
protein tyrosine phosphatase, non-receptor type 18 (brain-derived)
Omim ID
606587Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, the mitotic cycle, and oncogenic transformation. This PTP contains a PEST motif, which often serves as a protein-protein interaction domain, and may be related to protein intracellular half-live. This protein can differentially dephosphorylate autophosphorylated tyrosine kinases that are overexpressed in tumor tissues, and it appears to regulate HER2, a member of the epidermal growth factor receptor family of receptor tyrosine kinases. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
brain-derived phosphatase|protein tyrosine phosphatase, non-receptor type 18
-
Interactome
-
Publication Reference
-
BAR Proteins PSTPIP1/2 Regulate Podosome Dynamics and the Resorption Activity of Osteoclasts.
Sztacho M, Segeletz S, Sanchez-Fernandez MA, Czupalla C, Niehage C, Hoflack B.
PLoS One 2016 Oct; 11(10):e0164829.
Application：IF, Mouse, Raw 264.8 cells.
-
BAR Proteins PSTPIP1/2 Regulate Podosome Dynamics and the Resorption Activity of Osteoclasts.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com