Product Browser

Last updated: 2016/12/11

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LHX6 (Human) Recombinant Protein (Q01)

  • Catalog # : H00026468-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human LHX6 partial ORF ( NP_055183, 274 a.a. - 363 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • HKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFSSPERARMVTLHGYIESQVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.64
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00026468-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • LHX6
  • Gene Alias:
  • LHX6.1,MGC119542,MGC119544,MGC119545
  • Gene Description:
  • LIM homeobox 6
  • Gene Summary:
  • This gene encodes a member of a large protein family that contains the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator and may be involved in the control of differentiation and development of neural and lymphoid cells. Two alternatively spliced transcript variants encoding distinct isoforms have been described for this gene. Alternatively spliced transcript variants have been identified, but their biological validity has not been determined. [provided by RefSeq
  • Other Designations:
  • LIM homeobox protein 6,LIM homeodomain protein 6.1,OTTHUMP00000022046,OTTHUMP00000064113,OTTHUMP00000064114,OTTHUMP00000196635
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook