Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LHX6 polyclonal antibody (A01)

  • Catalog # : H00026468-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant LHX6.
  • Immunogen:
  • LHX6 (NP_055183, 274 a.a. ~ 363 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • HKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFSSPERARMVTLHGYIESQVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00026468-A01
    Western Blot detection against Immunogen (36.01 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • LHX6
  • Gene Alias:
  • LHX6.1,MGC119542,MGC119544,MGC119545
  • Gene Description:
  • LIM homeobox 6
  • Gene Summary:
  • This gene encodes a member of a large protein family that contains the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator and may be involved in the control of differentiation and development of neural and lymphoid cells. Two alternatively spliced transcript variants encoding distinct isoforms have been described for this gene. Alternatively spliced transcript variants have been identified, but their biological validity has not been determined. [provided by RefSeq
  • Other Designations:
  • LIM homeobox protein 6,LIM homeodomain protein 6.1,OTTHUMP00000022046,OTTHUMP00000064113,OTTHUMP00000064114,OTTHUMP00000196635
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook