HSPB8 monoclonal antibody (M02), clone 5D7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HSPB8.
Immunogen
HSPB8 (NP_055180, 97 a.a. ~ 196 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (95)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of HSPB8 expression in transfected 293T cell line by HSPB8 monoclonal antibody (M02), clone 5D7.
Lane 1: HSPB8 transfected lysate(35.446 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HSPB8 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — HSPB8
Entrez GeneID
26353GeneBank Accession#
NM_014365Protein Accession#
NP_055180Gene Name
HSPB8
Gene Alias
CMT2L, DHMN2, E2IG1, H11, HMN2, HMN2A, HSP22
Gene Description
heat shock 22kDa protein 8
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The expression of this gene in induced by estrogen in estrogen receptor-positive breast cancer cells, and this protein also functions as a chaperone in association with Bag3, a stimulator of macroautophagy. Thus, this gene appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in this gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease. [provided by RefSeq
Other Designations
E2-induced gene 1|heat shock 27kDa protein 8|heat shock protein beta-8|protein kinase H11|small stress protein-like protein HSP22
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com