FBXO6 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human FBXO6 protein.
Immunogen
FBXO6 (NP_060908.1, 1 a.a. ~ 293 a.a) full-length human protein.
Sequence
MDAPHSKAALDSINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLMTLWKRKCLREGFITKDWDQPVADWKIFYFLRSLHRNLLRNPCAEEDMFAWQIDFNGGDRWKVESLPGAHGTDFPDPKVKKYFVTSYEMCLKSQLVDLVAEGYWEELLDTFRPDIVVKDWFAARADCGCTYQLKVQLASADYFVLASFEPPPVTIQQWNNATWTEVSYTFSDYPRGVRYILFQHGGRDTQYWAGWYGPRVTNSSIVVSPKMTRNQASSEAQPGQKHGQEEAAQSPYRAVVQIF
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (75); Rat (78)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
FBXO6 MaxPab rabbit polyclonal antibody. Western Blot analysis of FBXO6 expression in human kidney.Western Blot (Cell lysate)
FBXO6 MaxPab rabbit polyclonal antibody. Western Blot analysis of FBXO6 expression in HepG2.Western Blot (Transfected lysate)
Western Blot analysis of FBXO6 expression in transfected 293T cell line (H00026270-T01) by FBXO6 MaxPab polyclonal antibody.
Lane 1: FBXO6 transfected lysate(33.90 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — FBXO6
Entrez GeneID
26270GeneBank Accession#
NM_018438.4Protein Accession#
NP_060908.1Gene Name
FBXO6
Gene Alias
FBG2, FBS2, FBX6, Fbx6b
Gene Description
F-box protein 6
Omim ID
605647Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class, and its C-terminal region is highly similar to that of rat NFB42 (neural F Box 42 kDa) which may be involved in the control of the cell cycle. [provided by RefSeq
Other Designations
F-box only protein 6|F-box protein FBG2|F-box protein Fbx6|OTTHUMP00000002267
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com