FBXW8 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant FBXW8.
Immunogen
FBXW8 (NP_699179, 499 a.a. ~ 598 a.a) partial recombinant protein with GST tag.
Sequence
VWDYRMNQKLWEVYSGHPVQHISFSSHSLITANVPYQTVMRNADLDSFTTHRRHRGLIRAYEFAVDQLAFQSPLPVCRSSCDAMATHYYDLALAFPYNHV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (74); Rat (74)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — FBXW8
Entrez GeneID
26259GeneBank Accession#
NM_153348Protein Accession#
NP_699179Gene Name
FBXW8
Gene Alias
FBW6, FBW8, FBX29, FBXO29, FBXW6, MGC33534
Gene Description
F-box and WD repeat domain containing 8
Omim ID
609073Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into three classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene contains a WD-40 domain, in addition to an F-box motif, so it belongs to the Fbw class. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq
Other Designations
F-box and WD-40 domain protein 8|F-box only protein 29
-
Interactome
-
Pathway
-
Publication Reference
-
Effect of Ursolic Acid on MAPK in Cyclin D1 Signaling and RING-Type E3 Ligase (SCF E3s) in Two Endometrial Cancer Cell Lines.
Achiwa Y, Hasegawa K, Udagawa Y.
Nutrition and Cancer 2013 Oct; 65(7):1026.
Application:WB-Ce, Human, SNG-2, HEC108 cells.
-
A Novel Mechanism by Which Thiazolidinediones Facilitate the Proteasomal Degradation of Cyclin D1 in Cancer Cells.
Wei S, Yang HC, Chuang HC, Yang J, Kulp SK, Lu PJ, Lai MD, Chen CS.
The Journal of Biological Chemistry 2008 Jul; 283(39):26759.
-
Effect of Ursolic Acid on MAPK in Cyclin D1 Signaling and RING-Type E3 Ligase (SCF E3s) in Two Endometrial Cancer Cell Lines.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com