CABYR purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
CABYR MaxPab polyclonal antibody. Western Blot analysis of CABYR expression in human liver.
Western Blot (Transfected lysate)
Western Blot analysis of CABYR expression in transfected 293T cell line (H00026256-T02) by CABYR MaxPab polyclonal antibody.
Lane 1: CABYR transfected lysate(41.10 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human CABYR protein.
Immunogen
CABYR (NP_619585.1, 1 a.a. ~ 379 a.a) full-length human protein.
Sequence
MISSKPRLVVPYGLKTLLEGISRAVLKTNPSNINQFAAAYFQELTMYRGNTTMDIKDLVKQFHQIKVEKWSEGTTPQKKLECLKEPGKTSVESKVPTQMEKSTDTDEDNVTRTEYSDKTTQFPSVYAVPGTEQTEAVGGLSSKPATPKTTTPPSSPPPTAVSPEFAYVPADPAQLAAQMLAMATSERGQPPPCSNMWTLYCLTDKNQQGHPSPPPAPGPFPQATLYLPNPKDPQFQQHPPKVTFPTYVMGDTKKTSAPPFILVGSNVQEAQGWKPLPGHAVVSQSDVLRYVAMQVPIAVPADEKYQKHTLSPQNANPPSGQDVPRPKSPVFLSVAFPVEDVAKKSSGSGDKCAPFGSYGIAGEVTVTTAHKRRKAETEN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (67); Rat (68)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
CABYR MaxPab polyclonal antibody. Western Blot analysis of CABYR expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of CABYR expression in transfected 293T cell line (H00026256-T02) by CABYR MaxPab polyclonal antibody.
Lane 1: CABYR transfected lysate(41.10 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CABYR
Entrez GeneID
26256GeneBank Accession#
NM_138644.1Protein Accession#
NP_619585.1Gene Name
CABYR
Gene Alias
CBP86, FSP-2, FSP2, MGC9117
Gene Description
calcium binding tyrosine-(Y)-phosphorylation regulated
Gene Ontology
HyperlinkGene Summary
To reach fertilization competence, spermatozoa undergo a series of morphological and molecular maturational processes, termed capacitation, involving protein tyrosine phosphorylation and increased intracellular calcium. The protein encoded by this gene localizes to the principal piece of the sperm flagellum in association with the fibrous sheath and exhibits calcium-binding when phosphorylated during capacitation. A pseudogene on chromosome 3 has been identified for this gene. Transcript variants of this gene encode multiple protein isoforms. An additional transcript and isoform has not been fully characterized. [provided by RefSeq
Other Designations
OTTHUMP00000035470|calcium binding tyrosine-(Y)-phosphorylation regulated (fibrousheathin 2)|calcium-binding tyrosine phosphorylation-regulated protein|calcium-binding tyrosine-(Y)-phosphorylation regulated (fibrousheathin 2)|fibrousheathin 2|fibrousheath
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com