Product Browser

Last updated: 2017/4/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LCE2B (Human) Recombinant Protein (P01)

  • Catalog # : H00026239-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human LCE2B full-length ORF ( AAI46414.1, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MSCQQNQQQCQPPPKCPPKCTPKCPPKCPPKCLPQCPAPCSPAVSSCCGPISGGCCGPSSGGCCNSGAGGCCLSHHRPRLFHRRRHQSPDCCESEPSGGSGCCHSSGGCC
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 38.5
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • LCE2B
  • Gene Alias:
  • LEP10,SPRL1B,XP5
  • Gene Description:
  • late cornified envelope 2B
  • Gene Summary:
  • This gene is one of the at least 20 genes expressed during epidermal differentiation and located on chromosomal band 1q21. This gene is involved in epidermal differentiation, and it is expressed at high levels in normal and psoriatic skin, but not in cultured keratinocytes or in any other tested cell types or tissues. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000014334,late envelope protein 10,skin-specific protein,small proline rich-like (epidermal differentiation complex) 1B
  • RSS
  • YouTube
  • Linkedin
  • Facebook