FBXO2 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
FBXO2 MaxPab polyclonal antibody. Western Blot analysis of FBXO2 expression in rat brain.
Western Blot (Transfected lysate)
Western Blot analysis of FBXO2 expression in transfected 293T cell line (H00026232-T01) by FBXO2 MaxPab polyclonal antibody.
Lane 1: FBXO2 transfected lysate(32.56 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human FBXO2 protein.
Immunogen
FBXO2 (NP_036300.2, 1 a.a. ~ 296 a.a) full-length human protein.
Sequence
MDGDGDPESVGQPEEASPEEQPEEASAEEERPEDQQEEEAAAAAAYLDELPEPLLLRVLAALPAAELVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPEGGVEEERDHWQQFYFLSKRRRNLLRNPCGEEDLEGWCDVEHGGDGWRVEELPGDSGVEFTHDESVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRSDAGCLYELTVKLLSEHENVLAEFSSGQVAVPQDSDGGGWMEISHTFTDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (87); Rat (88)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
FBXO2 MaxPab polyclonal antibody. Western Blot analysis of FBXO2 expression in rat brain.Western Blot (Transfected lysate)
Western Blot analysis of FBXO2 expression in transfected 293T cell line (H00026232-T01) by FBXO2 MaxPab polyclonal antibody.
Lane 1: FBXO2 transfected lysate(32.56 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — FBXO2
Entrez GeneID
26232GeneBank Accession#
NM_012168.4Protein Accession#
NP_036300.2Gene Name
FBXO2
Gene Alias
FBG1, FBX2, Fbs1, NFB42
Gene Description
F-box protein 2
Omim ID
607112Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. This protein is highly similar to the rat NFB42 (neural F Box 42 kDa) protein which is enriched in the nervous system and may play a role in maintaining neurons in a postmitotic state. [provided by RefSeq
Other Designations
F-box gene 1|F-box only protein 2|OTTHUMP00000002066
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com