LRRC29 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of LRRC29 expression in transfected 293T cell line (H00026231-T01) by LRRC29 MaxPab polyclonal antibody.
Lane 1: LRRC29 transfected lysate(24.53 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human LRRC29 protein.
Immunogen
LRRC29 (NP_001004055.1, 1 a.a. ~ 223 a.a) full-length human protein.
Sequence
MYSSGWPAGAAEPRHGRGRELAQALGCMHGAPSQLASLSLAHCSSLKSRPELEHQASGTKDACPEPQGPSLLTLRALQELDLTACSKLTDASLAKVLQFLQLRQLSLSLLPELTDNGLVAVARGCPSLEHLALSHCSRLSDKGWAQAASSWPRLQHLNLSSCSQLIEQTLDAIGQACRQLRVLDVATCPGINMAAVRRFQAQLPQVSCVQSRFVGGADLTLTL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (80); Rat (80)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of LRRC29 expression in transfected 293T cell line (H00026231-T01) by LRRC29 MaxPab polyclonal antibody.
Lane 1: LRRC29 transfected lysate(24.53 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — LRRC29
Entrez GeneID
26231GeneBank Accession#
NM_001004055.1Protein Accession#
NP_001004055.1Gene Name
LRRC29
Gene Alias
FBL9, FBXL9
Gene Description
leucine rich repeat containing 29
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains 9 tandem leucine-rich repeats. Two transcript variants encoding the same protein have been found for this gene. Other variants may occur, but their full-length natures have not been characterized. [provided by RefSeq
Other Designations
F-box and leucine-rich repeat protein 9|F-box protein FBL9
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com