Product Browser

Last updated: 2017/1/15
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BRDG1 polyclonal antibody (A01)

  • Catalog # : H00026228-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant BRDG1.
  • Immunogen:
  • BRDG1 (NP_036240, 186 a.a. ~ 293 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • EATEMLQKNPSLGNMILRPGSDSRNYSITIRQEIDIPRIKHYKVMSVGQNYTIELEKPVTLPNLFSVIDYFVKETRGNLRPFICSTDENTGQEPSMEGRSEKLKKNPH
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Gene Name:
  • STAP1
  • Gene Alias:
  • BRDG1,STAP-1
  • Gene Description:
  • signal transducing adaptor family member 1
  • Gene Summary:
  • The protein encoded by this gene functions as a docking protein acting downstream of Tec tyrosine kinase in B cell antigen receptor signaling. The protein is directly phosphorylated by Tec in vitro where it participates in a postive feedback loop, increasing Tec activity. [provided by RefSeq
  • Other Designations:
  • BCR downstream signaling 1,OTTHUMP00000159640,signal-transducing adaptor protein-1
  • RSS
  • YouTube
  • Linkedin
  • Facebook