Product Browser

Last updated: 2016/12/11
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SPAG8 (Human) Recombinant Protein (Q01)

  • Catalog # : H00026206-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SPAG8 partial ORF ( NP_036568.1, 321 a.a. - 421 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • LKSPMPSSTTQKDSYQPPGNVYWPLRGKREAMLEMLLQHQICKEVQAEQEPTRKLFEVESVTHHDYRMELAQAGTPAPTKPHDYRQEQPETFWIQRAPQLP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.85
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00026206-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • SPAG8
  • Gene Alias:
  • BS-84,HSD-1,MGC26201,SMP1,SPAG3,hSMP-1
  • Gene Description:
  • sperm associated antigen 8
  • Gene Summary:
  • The correlation of anti-sperm antibodies with cases of unexplained infertility implicates a role for these antibodies in blocking fertilization. Improved diagnosis and treatment of immunologic infertility, as well as identification of proteins for targeted contraception, are dependent on the identification and characterization of relevant sperm antigens. The protein encoded by this gene is recognized by sperm agglutinating antibodies from an infertile woman. This protein is localized in germ cells of the testis at all stages of spermatogenesis and is localized to the acrosomal region of mature spermatozoa. Alternatively spliced variants that encode different protein isoforms have been described but the full-length sequences of only two have been determined. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000021352,sperm membrane protein 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook