SENP3 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
SENP3 MaxPab rabbit polyclonal antibody. Western Blot analysis of SENP3 expression in HepG2.
Western Blot (Transfected lysate)
Western Blot analysis of SENP3 expression in transfected 293T cell line (H00026168-T02) by SENP3 MaxPab polyclonal antibody.
Lane 1: SENP3 transfected lysate(65.00 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human SENP3 protein.
Immunogen
SENP3 (NP_056485.2, 1 a.a. ~ 574 a.a) full-length human protein.
Sequence
MKETIQGTGSWGPEPPGPGIPPAYSSPRRERLRWPPPPKPRLKSGGGFGPDPGSGTTVPARRLPVPRPSFDASASEEEEEEEEEEDEDEEEEVAAWRLPPRWSQLGTSQRPRPSRPTHRKTCSQRRRRAMRAFRMLLYSKSTSLTFHWKLWGRHRGRRRGLAHPKNHLSPQQGGATPQVPSPCCRFDSPRGPPPPRLGLLGALMAEDGVRGSPPVPSGPPMEEDGLRWTPKSPLDPDSGLLSCTLPNGFGGQSGPEGERSLAPPDASILISNVCSIGDHVAQELFQGSDLGMAEEAERPGEKAGQHSPLREEHVTCVQSILDEFLQTYGSLIPLSTDEVVEKLEDIFQQEFSTPSRKGLVLQLIQSYQRMPGNAMVRGFRVAYKRHVLTMDDLGTLYGQNWLNDQVMNMYGDLVMDTVPEKVHFFNSFFYDKLRTKGYDGVKRWTKNVDIFNKELLLIPIHLEVHWSLISVDVRRRTITYFDSQRTLNRRCPKHIAKYLQAEAVKKDRLDFHQGWKGYFKMNVARQNNDSDCGAFVLQYCKHLALSQPFSFTQQDMPKLRRQIYKELCHCKLTV
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (94)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SENP3 MaxPab rabbit polyclonal antibody. Western Blot analysis of SENP3 expression in HepG2.Western Blot (Transfected lysate)
Western Blot analysis of SENP3 expression in transfected 293T cell line (H00026168-T02) by SENP3 MaxPab polyclonal antibody.
Lane 1: SENP3 transfected lysate(65.00 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — SENP3
Entrez GeneID
26168GeneBank Accession#
NM_015670.4Protein Accession#
NP_056485.2Gene Name
SENP3
Gene Alias
DKFZp586K0919, DKFZp762A152, SMT3IP1, SSP3
Gene Description
SUMO1/sentrin/SMT3 specific peptidase 3
Gene Ontology
HyperlinkGene Summary
The reversible posttranslational modification of proteins by the addition of small ubiquitin-like SUMO proteins (see SUMO1; MIM 601912) is required for numerous biologic processes. SUMO-specific proteases, such as SENP3, are responsible for the initial processing of SUMO precursors to generate a C-terminal diglycine motif required for the conjugation reaction. They also have isopeptidase activity for the removal of SUMO from high molecular mass SUMO conjugates (Di Bacco et al., 2006 [PubMed 16738315]).[supplied by OMIM
Other Designations
SUMO1/sentrin/SMT3 specific protease 3|sentrin/SUMO-specific protease 3
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com