Product Browser

Last updated: 2017/10/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ZBTB20 monoclonal antibody (M01), clone 1F3

  • Catalog # : H00026137-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant ZBTB20.
  • Immunogen:
  • ZBTB20 (NP_056457, 451 a.a. ~ 542 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • FLFSLPQPLAGQQTQFVTVSQPGLSTFTAQLPAPQPLASSAGHSTASGQGEKKPYECTLCNKTFTAKQNYVKHMFVHTGEKPHQCSICWRSF
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00026137-M01
    Western Blot detection against Immunogen (35.86 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged ZBTB20 is 0.3 ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Gene Name:
  • ZBTB20
  • Gene Alias:
  • DKFZp566F123,DPZF,HOF,ODA-8S,ZNF288
  • Gene Description:
  • zinc finger and BTB domain containing 20
  • Other Designations:
  • A930017C21Rik,ortholog of mouse BTB (broad complex tramtrack bric-brac)/POZ (px-virus and zinc finger) domain zinc finger factor HOF,ortholog of mouse zinc finger protein 288,zinc finger 288,zinc finger protein 288
  • RSS
  • YouTube
  • Linkedin
  • Facebook