TES monoclonal antibody (M01), clone 1G11-B7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
TES monoclonal antibody (M01), clone 1G11-B7 Western Blot analysis of TES expression in K-562 ( Cat # L009V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of TES expression in transfected 293T cell line by TES monoclonal antibody (M01), clone 1G11-B7.
Lane 1: TES transfected lysate(48 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TES on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 3 ug/ml]
Immunofluorescence
Immunofluorescence of monoclonal antibody to TES on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (72.05 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant TES.
Immunogen
TES (AAH01451, 1 a.a. ~ 421 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MDLENKVKKMGLGHEQGFGAPCLKCKEKCEGFELHFWRKICRNCKCGQEEHDVLLSNEEDRKVGKLFEDTKYTTLIAKLKSDGIPMYKRNVMILTNPVAAKKNVSINTVTYEWAPPVQNQALARQYMQMLPKEKQPVAGSEGAQYRKKQLAKQLPAHDQDPSKCHELSPREVKEMEQFVKKYKSEALGVGDVKLPCEMDAQGPKQMNIPGGDRSTPAAVGAMEDKSAEHKRTQYSCYCCKLSMKEGDPAIYAERAGYDKLWHPACFVCSTCHELLVDMIYFWKNEKLYCGRHYCDSEKPRCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEIYVMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTYNNFSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSVECKKRMS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92); Rat (93)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (72.05 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TES monoclonal antibody (M01), clone 1G11-B7 Western Blot analysis of TES expression in K-562 ( Cat # L009V1 ).Western Blot (Transfected lysate)
Western Blot analysis of TES expression in transfected 293T cell line by TES monoclonal antibody (M01), clone 1G11-B7.
Lane 1: TES transfected lysate(48 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TES on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 3 ug/ml]ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to TES on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — TES
Entrez GeneID
26136GeneBank Accession#
BC001451Protein Accession#
AAH01451Gene Name
TES
Gene Alias
DKFZp586B2022, MGC1146, TESS, TESS-2
Gene Description
testis derived transcript (3 LIM domains)
Omim ID
606085Gene Ontology
HyperlinkGene Summary
Cancer-associated chromosomal changes often involve regions containing fragile sites. This gene maps to a commom fragile site on chromosome 7q31.2 designated FRA7G. This gene is similar to mouse Testin, a testosterone-responsive gene encoding a Sertoli cell secretory protein containing three LIM domains. LIM domains are double zinc-finger motifs that mediate protein-protein interactions between transcription factors, cytoskeletal proteins and signaling proteins. Multiple protein isoforms are encoded by transcript variants of this gene. [provided by RefSeq
Other Designations
testin
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com