Product Browser

Last updated: 2016/11/27
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TRPC4AP polyclonal antibody (A01)

  • Catalog # : H00026133-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant TRPC4AP.
  • Immunogen:
  • TRPC4AP (NP_056453, 341 a.a. ~ 451 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • VANEESEHNQASIVFPPPGASEENGLPHTSARTQLPQSMKIMHEIMYKLEVLYVLCVLLMGRQRNQVHRMIAEFKLIPGLNNLFDKLIWRKHSASALVLHGHNQNCDCSPD
  • Host:
  • Mouse
  • Reactivity:
  • Human, Mouse
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00026133-A01
    Western Blot detection against Immunogen (38.32 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • TRPC4AP polyclonal antibody (A01), Lot # GSK10060112QCS1. Western Blot analysis of TRPC4AP expression in Raw 264.7. (Isoform : 59.546 kDa)
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • TRPC4AP
  • Gene Alias:
  • C20orf188,TRRP4AP,TRUSS
  • Gene Description:
  • transient receptor potential cation channel, subfamily C, member 4 associated protein
  • Other Designations:
  • OTTHUMP00000030719,TRP4-associated protein,TRPC4-associated protein,short transient receptor potential channel 4 associated protein,tumor necrosis factor receptor-associated ubiquitous scaffolding and signaling protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook