PRPF31 monoclonal antibody (M02), clone 8E1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
PRPF31 monoclonal antibody (M02), clone 8E1. Western Blot analysis of PRPF31 expression in human liver.
Western Blot (Cell lysate)
PRPF31 monoclonal antibody (M02), clone 8E1. Western Blot analysis of PRPF31 expression in K-562.
Western Blot (Cell lysate)
PRPF31 monoclonal antibody (M02), clone 8E1. Western Blot analysis of PRPF31 expression in PC-12.
Western Blot (Transfected lysate)
Western Blot analysis of PRPF31 expression in transfected 293T cell line by PRPF31 monoclonal antibody (M02), clone 8E1.
Lane 1: PRPF31 transfected lysate (Predicted MW: 60.01 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PRPF31 is 1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PRPF31.
Immunogen
PRPF31 (NP_056444, 400 a.a. ~ 499 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GKSGSGRVRQTQVNEATKARISKTLQRTLQKQSVVYGGKSTIRDRSSGTASSVAFTPLQGLEIVNPQAAEKKVAEANQKYFSSMAEFLKVKGEKSGLMST
Host
Mouse
Reactivity
Human, Rat
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PRPF31 monoclonal antibody (M02), clone 8E1. Western Blot analysis of PRPF31 expression in human liver.Western Blot (Cell lysate)
PRPF31 monoclonal antibody (M02), clone 8E1. Western Blot analysis of PRPF31 expression in K-562.Western Blot (Cell lysate)
PRPF31 monoclonal antibody (M02), clone 8E1. Western Blot analysis of PRPF31 expression in PC-12.Western Blot (Transfected lysate)
Western Blot analysis of PRPF31 expression in transfected 293T cell line by PRPF31 monoclonal antibody (M02), clone 8E1.
Lane 1: PRPF31 transfected lysate (Predicted MW: 60.01 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PRPF31 is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — PRPF31
Entrez GeneID
26121GeneBank Accession#
NM_015629Protein Accession#
NP_056444Gene Name
PRPF31
Gene Alias
DKFZp566J153, NY-BR-99, PRP31, RP11
Gene Description
PRP31 pre-mRNA processing factor 31 homolog (S. cerevisiae)
Gene Ontology
HyperlinkGene Summary
This gene encodes a component of the spliceosome complex and is one of several retinitis pigmentosa-causing genes. When the gene product is added to the spliceosome complex, activation occurs
Other Designations
OTTHUMP00000068806|pre-mRNA processing factor 31 homolog
-
Interactome
-
Disease
-
Publication Reference
-
An integrative analysis of colon cancer identifies an essential function for PRPF6 in tumor growth.
Adler AS, McCleland ML, Yee S, Yaylaoglu M, Hussain S, Cosino E, Quinones G, Modrusan Z, Seshagiri S, Torres E, Chopra VS, Haley B, Zhang Z, Blackwood EM, Singh M, Junttila M, Stephan JP, Liu J, Pau G, Fearon ER, Jiang Z, Firestein R.
Genes & Development 2014 May; 28(10):1068.
Application：WB, Human, COLO 678, HCA-7, HT55, SW948, SK-CO-1, CL-40, DLD-1, SW620, LS1034, C2BBe1, RKO, KM-12, SW1463, HCT-15, SW1417, SW48, SW837 cells.
-
An integrative analysis of colon cancer identifies an essential function for PRPF6 in tumor growth.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com