Product Browser

Last updated: 2017/11/19
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PRPF31 polyclonal antibody (A01)

  • Catalog # : H00026121-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PRPF31.
  • Immunogen:
  • PRPF31 (NP_056444, 400 a.a. ~ 499 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • GKSGSGRVRQTQVNEATKARISKTLQRTLQKQSVVYGGKSTIRDRSSGTASSVAFTPLQGLEIVNPQAAEKKVAEANQKYFSSMAEFLKVKGEKSGLMST
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00026121-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • PRPF31 polyclonal antibody (A01), Lot # 060619JCS1 Western Blot analysis of PRPF31 expression in HeLa ( Cat # L013V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • PRPF31
  • Gene Alias:
  • DKFZp566J153,NY-BR-99,PRP31,RP11
  • Gene Description:
  • PRP31 pre-mRNA processing factor 31 homolog (S. cerevisiae)
  • Gene Summary:
  • This gene encodes a component of the spliceosome complex and is one of several retinitis pigmentosa-causing genes. When the gene product is added to the spliceosome complex, activation occurs
  • Other Designations:
  • OTTHUMP00000068806,pre-mRNA processing factor 31 homolog
  • RSS
  • YouTube
  • Linkedin
  • Facebook