Product Browser

Last updated: 2017/1/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LDLRAP1 (Human) Recombinant Protein (P01)

  • Catalog # : H00026119-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human LDLRAP1 full-length ORF ( AAH29770, 1 a.a. - 263 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MLFSLKYLGMTLVEQPKGEELSAAAIKRIVATAKASGKKLQKVTLKVSPRGIILTDNLTNQLIENVSIYRISYCTADKMHDKVFAYIAQSQHNQSLECHAFLCTKRKMAQAVTLTVAQAFKVAFEFWQVSKEEKEKRDKASQEGGDVLGARQDCTPPLKSLVATGNLLDLEETAKAPLSTVSANTTNMDEVPRPQALSGSSVVWELDDGLDEAFSRLAQSRTNPQVLDTGLTAQDMHYAQCLSPVDWDKPDSSGTEQDDLFSF
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 54.67
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00026119-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • LDLRAP1
  • Gene Alias:
  • ARH,ARH1,ARH2,DKFZp586D0624,FHCB1,FHCB2,MGC34705
  • Gene Description:
  • low density lipoprotein receptor adaptor protein 1
  • Gene Summary:
  • The protein encoded by this gene is a cytosolic protein which contains a phosphotyrosine binding (PTD) domain. The PTD domain has been found to interact with the cytoplasmic tail of the LDL receptor. Mutations in this gene lead to LDL receptor malfunction and cause the disorder autosomal recessive hypercholesterolaemia. [provided by RefSeq
  • Other Designations:
  • LDL receptor adaptor protein,OTTHUMP00000008526,autosomal recessive hypercholesterolemia protein
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook