LDLRAP1 monoclonal antibody (M01), clone 4G4-D5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
LDLRAP1 monoclonal antibody (M01), clone 4G4-D5 Western Blot analysis of LDLRAP1 expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot (Transfected lysate)
Western Blot analysis of LDLRAP1 expression in transfected 293T cell line by LDLRAP1 monoclonal antibody (M01), clone 4G4-D5.
Lane 1: LDLRAP1 transfected lysate(29 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to LDLRAP1 on formalin-fixed paraffin-embedded human maligant fibrous histiocytoma tissue. [antibody concentration 2 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LDLRAP1 is 1 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to LDLRAP1 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (54.67 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant LDLRAP1.
Immunogen
LDLRAP1 (AAH29770, 1 a.a. ~ 263 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MLFSLKYLGMTLVEQPKGEELSAAAIKRIVATAKASGKKLQKVTLKVSPRGIILTDNLTNQLIENVSIYRISYCTADKMHDKVFAYIAQSQHNQSLECHAFLCTKRKMAQAVTLTVAQAFKVAFEFWQVSKEEKEKRDKASQEGGDVLGARQDCTPPLKSLVATGNLLDLEETAKAPLSTVSANTTNMDEVPRPQALSGSSVVWELDDGLDEAFSRLAQSRTNPQVLDTGLTAQDMHYAQCLSPVDWDKPDSSGTEQDDLFSF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (87); Rat (88)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (54.67 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
LDLRAP1 monoclonal antibody (M01), clone 4G4-D5 Western Blot analysis of LDLRAP1 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of LDLRAP1 expression in transfected 293T cell line by LDLRAP1 monoclonal antibody (M01), clone 4G4-D5.
Lane 1: LDLRAP1 transfected lysate(29 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to LDLRAP1 on formalin-fixed paraffin-embedded human maligant fibrous histiocytoma tissue. [antibody concentration 2 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LDLRAP1 is 1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to LDLRAP1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — LDLRAP1
Entrez GeneID
26119GeneBank Accession#
BC029770Protein Accession#
AAH29770Gene Name
LDLRAP1
Gene Alias
ARH, ARH1, ARH2, DKFZp586D0624, FHCB1, FHCB2, MGC34705
Gene Description
low density lipoprotein receptor adaptor protein 1
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a cytosolic protein which contains a phosphotyrosine binding (PTD) domain. The PTD domain has been found to interact with the cytoplasmic tail of the LDL receptor. Mutations in this gene lead to LDL receptor malfunction and cause the disorder autosomal recessive hypercholesterolaemia. [provided by RefSeq
Other Designations
LDL receptor adaptor protein|OTTHUMP00000008526|autosomal recessive hypercholesterolemia protein
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Disabled-2 protein facilitates assembly polypeptide-2-independent recruitment of cystic fibrosis transmembrane conductance regulator to endocytic vesicles in polarized human airway epithelial cells.
Cihil KM, Ellinger P, Fellows A, Stolz DB, Madden DR, Swiatecka-Urban A.
The Journal of Biological Chemistry 2012 Apr; 287(18):15087.
Application：WB-Tr, Human, CFBE41o- cells.
-
Autosomal recessive hypercholesterolemia in Spanish kindred due to a large deletion in the ARH gene.
Quagliarini F, Vallve JC, Campagna F, Alvaro A, Fuentes-Jimenez FJ, Sirinian MI, Meloni F, Masana L, Arca M.
Molecular Genetics and Metabolism 2007 Aug; 92(3):243.
Application：WB, Human, EBV-immortalized lymphocytes.
-
Disabled-2 protein facilitates assembly polypeptide-2-independent recruitment of cystic fibrosis transmembrane conductance regulator to endocytic vesicles in polarized human airway epithelial cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com