PTPN20B (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PTPN20B full-length ORF ( AAI41461.1, 1 a.a. - 226 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MSSPRDFRAEPVNDYEGNDSEAEDLNFRETLPSSSQENTPRSKVFENKVNSEKVKLSLRNFPHNDYEDVFEEPSESGSDPSMWTARGPFRRDRWSSEDEEAAGPSQALSPLLSDTRKIVSEGELDQLAQIRPLIFNFHEQTAIKDCLKILEEKTAAYDIMQEFMALELKNLPGEFNSGNQPSNREKNRYRDILPFQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
51.26
Interspecies Antigen Sequence
Mouse (48); Rat (49)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PTPN20B
Entrez GeneID
26095GeneBank Accession#
BC141460.1Protein Accession#
AAI41461.1Gene Name
PTPN20B
Gene Alias
DKFZp566K0524, DKFZp781P23155, bA42B19.1
Gene Description
protein tyrosine phosphatase, non-receptor type 20B
Omim ID
610631Gene Ontology
HyperlinkGene Summary
The product of this gene belongs to the family of classical tyrosine-specific protein tyrosine phosphatases. Many protein tyrosine phosphatases have been shown to regulate fundamental cellular processes and several are mutated in human diseases. Chromosome 10q contains a segmental duplication resulting in multiple copies of the protein tyrosine phosphatase, non-receptor type 20 gene. The two nearly identical copies are designated as PTPN20A and PTPN20B. A third copy is only partially duplicated and contains a pseudogene, designated as PTPN20C. This gene encodes the more telomeric copy, PTPN20B. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
OTTHUMP00000019540|OTTHUMP00000019541|OTTHUMP00000059234|protein tyrosine phosphatase, non-receptor type 20
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com