Product Browser

Last updated: 2017/3/26
  • Related Product Showcase
  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GPSM1 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00026086-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human GPSM1 protein.
  • Immunogen:
  • GPSM1 (AAH48343.1, 1 a.a. ~ 166 a.a) full-length human protein.
  • Sequence:
  • MDDQRCPLDDGQAGAAEATAAPTLEDRIAQPSMTASPQTEEFFDLIASSQSRRLDDQRASVGSLPGLRITHSNAGHLRGHGEPQEPGDDFFNMLIKYQSSRIDDQRCPPPDVLPRGPTMPDEDFFSLIQRVQAKRMDEQRVDLAGGPEQGAGGPPEPQQQCQPGAS
  • Host:
  • Mouse
  • Reactivity:
  • Human, Rat
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • GPSM1 MaxPab polyclonal antibody. Western Blot analysis of GPSM1 expression in rat brain.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of GPSM1 expression in transfected 293T cell line (H00026086-T01) by GPSM1 MaxPab polyclonal antibody.

    Lane 1: GPSM1 transfected lysate(18.26 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • GPSM1
  • Gene Alias:
  • AGS3,DKFZp727I051
  • Gene Description:
  • G-protein signaling modulator 1 (AGS3-like, C. elegans)
  • Gene Summary:
  • G proteins propagate intracellular signals initiated by G protein-coupled receptors. GPSM1, a receptor-independent activator of G protein signaling, is one of several factors that influence the basal activity of G protein signaling systems (Pizzinat et al., 2001 [PubMed 11278352]).[supplied by OMIM
  • Other Designations:
  • 1810037C22Rik,G-protein signalling modulator 1 (AGS3-like, C. elegans),OTTHUMP00000022584,OTTHUMP00000046384,OTTHUMP00000046385,activator of G-protein signaling 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook