LSM14A purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
LSM14A MaxPab polyclonal antibody. Western Blot analysis of LSM14A expression in human placenta.
Western Blot (Transfected lysate)
Western Blot analysis of LSM14A expression in transfected 293T cell line (H00026065-T01) by LSM14A MaxPab polyclonal antibody.
Lane 1: LSM14A transfected lysate(50.93 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human LSM14A protein.
Immunogen
LSM14A (AAH16842.1, 1 a.a. ~ 463 a.a) full-length human protein.
Sequence
MSGGTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPKPQCSLPQDPAIVQSSLGSSTSSFQSMGSYGPFGRMPTYSQFSPSSLVGQQFGAVGVAGSSLTSFGTETSNSGTLPQSSAVGSAFTQDTRSLKTQLSQGRSSPQLDPLRKSPTMEQAVQTASAHLPAPAAVGRRSPVSTRPLPSASQKAGENQEHRRAEVHKVSRPENEQLRNDNKRQVAPGAPSAPRRGRGGHRGGRGRFGIRRDGPMKFEKDFDFESANAQFNKEEIDREFHNKLKLKEDKLEKQEKPVNGEDKGDSGVDTQNSEGNADEEDPLGPNCYYDKTKSFFDNISCDDNRERRPTWAEERRLNAETFGIPLRPNRGRGGYRGRGGLGFRGGRGRGGGRGGTFTAPRGFRGGFRGGRGGREFADFEYRKDNKVAA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (94)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
LSM14A MaxPab polyclonal antibody. Western Blot analysis of LSM14A expression in human placenta.Western Blot (Transfected lysate)
Western Blot analysis of LSM14A expression in transfected 293T cell line (H00026065-T01) by LSM14A MaxPab polyclonal antibody.
Lane 1: LSM14A transfected lysate(50.93 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — LSM14A
Entrez GeneID
26065GeneBank Accession#
BC016842Protein Accession#
AAH16842.1Gene Name
LSM14A
Gene Alias
C19orf13, DKFZp434D1335, FAM61A, RAP55
Gene Description
LSM14A, SCD6 homolog A (S. cerevisiae)
Omim ID
610677Gene Ontology
HyperlinkGene Summary
Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM
Other Designations
LSM14 homolog A|RNA-associated protein 55|family with sequence similarity 61, member A
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com