Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SS18L1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00026039-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SS18L1 partial ORF ( NP_056373, 112 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • GLPPSSLLQGQIGNGPSHVSMQQTAPNTLPTTSMSISGPGYSHAGPASQGVPMQGQGTIGNYVSRTNINMQSNPVSMMQQQAATSHYSS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.53
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00026039-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • SS18L1
  • Gene Alias:
  • CREST,KIAA0693,LP2261,MGC26711,MGC78386
  • Gene Description:
  • synovial sarcoma translocation gene on chromosome 18-like 1
  • Gene Summary:
  • Synovial sarcomas occur most frequently in the extremities around large joints. More than 90% of cases have a recurrent and specific chromosomal translocation, t(X;18)(p11.2;q11.2), in which the 5-prime end of the SS18 gene (MIM 600192) is fused in-frame to the 3-prime end of the SSX1 (MIM 312820), SSX2 (MIM 300192), or SSX4 (MIM 300326) gene. The SS18L1 gene is homologous to SS18.[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000031468,SS18-like protein 1,SYT homolog 1,calcium-responsive transactivator
  • RSS
  • YouTube
  • Linkedin
  • Facebook