Product Browser

Last updated: 2017/11/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GORASP2 polyclonal antibody (A01)

  • Catalog # : H00026003-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant GORASP2.
  • Immunogen:
  • GORASP2 (NP_056345, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MGSSQSVEIPGGGTEGYHVLRVQENSPGHRAGLEPFFDFIVSINGSRLNKDNDTLKDLLKANVEKPVKMLIYSSKTLELRETSVTPSNLWGGQGLLGVSI
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00026003-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • GORASP2
  • Gene Alias:
  • DKFZp434D156,FLJ13139,GOLPH6,GRASP55,GRS2,p59
  • Gene Description:
  • golgi reassembly stacking protein 2, 55kDa
  • Gene Summary:
  • The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is involved in establishing the stacked structure of the Golgi apparatus. [provided by RefSeq
  • Other Designations:
  • golgi reassembly stacking protein 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook