Product Browser

Last updated: 2017/7/23
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MIZF polyclonal antibody (A01)

  • Catalog # : H00025988-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant MIZF.
  • Immunogen:
  • MIZF (NP_056332, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MPPPGKVPRKENLWLQCEWGSCSFVCSTMEKFFEHVTQHLQQHLHGSGEEEEEEEEDDPLEEEFSCLWQECGFCSLDSSADLIRHVYFHCYHTKLKQWGLQALQSQADLG
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00025988-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • MIZF
  • Gene Alias:
  • DKFZp434F162,HiNF-P,ZNF743
  • Gene Description:
  • MBD2-interacting zinc finger
  • Gene Summary:
  • MIZF interacts with methyl-CpG-binding protein-2 (MBD2; MIM 603547), a component of the MeCP1 histone deacetylase (HDAC) complex, and plays a role in DNA methylation and transcription repression.[supplied by OMIM
  • Other Designations:
  • MBD2 (methyl-CpG-binding protein)-interacting zinc finger protein,MBD2-interacting zinc finger 1,histone H4 gene-specific protein HiNF-P,histone nuclear factor P
  • RSS
  • YouTube
  • Linkedin
  • Facebook