Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SH2B (Human) Recombinant Protein (Q01)

  • Catalog # : H00025970-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SH2B partial ORF ( AAH10704, 327 a.a. - 426 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • GKAKHLRLSLNEEGQCRVQHLWFQSIFDMLEHFRVHPIPLESGGSSDVVLVSYVPSSQRQQGREQAGSHAGVCEGDGCHPDASCTLMPFGASDCVTDHLP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.63
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00025970-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • SH2B1
  • Gene Alias:
  • DKFZp547G1110,FLJ30542,KIAA1299,SH2-B,SH2B
  • Gene Description:
  • SH2B adaptor protein 1
  • Gene Summary:
  • This gene encodes a member of the SH2-domain containing mediators family. The encoded protein mediates activation of various kinases and may function in cytokine and growth factor receptor signaling and cellular transformation. Alternatively spliced transcript variants have been described. [provided by RefSeq
  • Other Designations:
  • SH2 domain-containing putative adapter SH2-B,SH2-B alpha signaling protein,SH2-B gamma signaling protein,SH2-B homolog
  • RSS
  • YouTube
  • Linkedin
  • Facebook